- - I have an affinity for: mythical beasts - scientific illustrations - art - propaganda - ephemera - minutiae - smooth lines - jade - Type O Negative - the number 7 - black and white - high contrast - vampires - life - death - inner realms - night - cities and bridges at night - Japan - Jolly - New York City - collections - books - nails - weapons - night scenes - robots - goddesses - post-rock - Batman - skylines - Long Distance Calling - - - - All images, unless otherwise noted, were taken from the Internet and are assumed to be in the public domain.
My Tumblr Playlist! Promote your Tumblr! Online Users

7th March 2013

Photo reblogged from нет прошлого, нет будущего with 174 notes

Tagged: braidsblue lipsticklipstickfreckles

Source: szexi

9th February 2013

Photo reblogged from Smokey Lips with 248 notes

shamelessocean:

source

shamelessocean:

source

Tagged: toplessnipplelaceblackblack lacelipslipstickveil

Source: shamelessocean

2nd January 2013

Photo with 38 notes

Tagged: cigaretteclose upillustrationlipsretrosmokingnailsteethlipstickfingernails

30th October 2012

Photo reblogged from with 14 notes

zararsizhaller:

dumanına karıştığımız sigaradan farksızdı aşk, zararlı.

zararsizhaller:

dumanına karıştığımız sigaradan farksızdı aşk, zararlı.

Tagged: black and whitesmokesmokingcigaretteblondelipstick

20th October 2012

Photo reblogged from FLASH DELIRIUM CASE with 1,167 notes

Tagged: lipseyelipstickeyebrowbeautyfemininefemaleblack and whiteteeth

Source: stevienikkiman

13th October 2012

Photo reblogged from Blood Beauty Divine with 1,733 notes

Tagged: FlickrMiley酷子Black and Whiteasianlipstickreflection

Source:

8th October 2012

Photo reblogged from GirlsFireAndSmokes with 34 notes

Tagged: black and whitesmokingcigarettelipstick

Source: lily-xo

11th September 2012

Photo with 11 notes

Tagged: fairuza balkblack and whitelipstickactresscelebrity

6th September 2012

Photo reblogged from Girl Watching with 325 notes

Tagged: smokingfemalelipstickcigaretteblack and whitewetborissovdeviantart

Source: dessicate

23rd August 2012

Photo reblogged from Oxidation9999-for adults only with 307 notes

Tagged: ditadita von teesecigarettesmokingsmokelipstick

Source: von-teese

15th August 2012

Photo reblogged from beautifulandbadgirls with 14 notes

Tagged: Asianaznsmokingcigarettecrucifixleatherlipstick

13th August 2012

Photo reblogged from An Infinite Coincidence with 1,967 notes

Tagged: blondepiercingpierced nippletattoosinkedlipslipstickblack and whiteLos Angeles Clippers

Source: fakesnakes

9th August 2012

Photo reblogged from RadioAlice with 11 notes

pinprick:

Wow! Certified Goddess… 

pinprick:

Wow! Certified Goddess… 

Tagged: Black and Whitenose ringlipstickfemalehair

Source: pinprick

6th August 2012

Photo with 9 notes

Smoky by Druid Dryp

Smoky by Druid Dryp

Tagged: smokysmokingcigarettefemalesmokelipsleatherlipstick

31st July 2012

Photo reblogged from The Art of Smoking with 9 notes

Tagged: lipssmokingwinecigarettefemalegirllipstickpolaroid

Source: thepolishprince